PDB entry 1l7p

View 1l7p on RCSB PDB site
Description: substrate bound phosphoserine phosphatase complex structure
Class: hydrolase
Keywords: Rossmann fold, beta-hairpin, four-helix bundle, Structural Genomics, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, HYDROLASE
Deposited on 2002-03-16, released 2002-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.229
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoserine Phosphatase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58989
      • engineered (10)
      • modified residue (42)
      • modified residue (173)
    Domains in SCOPe 2.08: d1l7pa_
  • Chain 'B':
    Compound: Phosphoserine Phosphatase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58989 (Start-210)
      • engineered (10)
      • modified residue (42)
      • modified residue (173)
    Domains in SCOPe 2.08: d1l7pb_
  • Heterogens: PO4, SEP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l7pA (A:)
    mekkkklilfnfdstlvnnetideiareagveeevkkitkeamegklnfeqslrkrvsll
    kdlpiekvekaikritptegaeetikelknrgyvvavvsggfdiavnkikeklgldyafa
    nrlivkdgkltgdvegevlkenakgeilekiakieginledtvavgdgandismfkkagl
    kiafcakpilkekadiciekrdlreilkyik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l7pA (A:)
    kkklilfnfdstlvnnetideiareagveeevkkitkeamegklnfeqslrkrvsllkdl
    piekvekaikritptegaeetikelknrgyvvavvsggfdiavnkikeklgldyafanrl
    ivkdgkltgdvegevlkenakgeilekiakieginledtvavgdgandismfkkaglkia
    fcakpilkekadiciekrdlreilkyik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l7pB (B:)
    mekkkklilfnfdstlvnnetideiareagveeevkkitkeamegklnfeqslrkrvsll
    kdlpiekvekaikritptegaeetikelknrgyvvavvsggfdiavnkikeklgldyafa
    nrlivkdgkltgdvegevlkenakgeilekiakieginledtvavgdgandismfkkagl
    kiafcakpilkekadiciekrdlreilkyik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l7pB (B:)
    ekkkklilfnfdstlvnnetideiareagveeevkkitkeamegklnfeqslrkrvsllk
    dlpiekvekaikritptegaeetikelknrgyvvavvsggfdiavnkikeklgldyafan
    rlivkdgkltgdvegevlkenakgeilekiakieginledtvavgdgandismfkkaglk
    iafcakpilkekadiciekrdlreilkyik