PDB entry 1l7o

View 1l7o on RCSB PDB site
Description: crystal structure of phosphoserine phosphatase in apo form
Class: hydrolase
Keywords: Rossmann fold, beta-hairpin, four-helix bundle, Structural Genomics, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, HYDROLASE
Deposited on 2002-03-16, released 2002-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-21, with a file datestamp of 2021-07-16.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoserine Phosphatase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ1594
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58989
      • modified residue (0)
      • engineered (10)
      • modified residue (42)
      • modified residue (173)
    Domains in SCOPe 2.08: d1l7oa_
  • Chain 'B':
    Compound: Phosphoserine Phosphatase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ1594
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58989 (0-210)
      • modified residue (0)
      • engineered (10)
      • modified residue (42)
      • modified residue (173)
    Domains in SCOPe 2.08: d1l7ob_
  • Heterogens: ZN, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l7oA (A:)
    mekkkklilfnfdstlvnnetideiareagveeevkkitkeamegklnfeqslrkrvsll
    kdlpiekvekaikritptegaeetikelknrgyvvavvsggfdiavnkikeklgldyafa
    nrlivkdgkltgdvegevlkenakgeilekiakieginledtvavgdgandismfkkagl
    kiafcakpilkekadiciekrdlreilkyik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l7oA (A:)
    kkklilfnfdstlvnnetideiareagveeevkkitnfeqslrkrvsllkdlpiekveka
    ikritptegaeetikelknrgyvvavvsggfdiavnkikeklgldyafanrlivkdgklt
    gdvegevlkenakgeilekiakieginledtvavgdgandismfkkaglkiafcakpilk
    ekadiciekrdlreilkyik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l7oB (B:)
    mekkkklilfnfdstlvnnetideiareagveeevkkitkeamegklnfeqslrkrvsll
    kdlpiekvekaikritptegaeetikelknrgyvvavvsggfdiavnkikeklgldyafa
    nrlivkdgkltgdvegevlkenakgeilekiakieginledtvavgdgandismfkkagl
    kiafcakpilkekadiciekrdlreilkyik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l7oB (B:)
    kkklilfnfdstlvnnetideiareagveeevkkitkeamegklnfeqslrkrvsllkdl
    piekvekaikritptegaeetikelknrgyvvavvsggfdiavnkikeklgldyafanrl
    ivkdgkltgdvegevlkenakgeilekiakieginledtvavgdgandismfkkaglkia
    fcakpilkekadiciekrdlreilkyik