PDB entry 1l7l

View 1l7l on RCSB PDB site
Description: Crystal structure of Pseudomonas aeruginosa lectin 1 determined by single wavelength anomalous scattering phasing method
Class: sugar binding protein
Keywords: Pseudomonas aeruginosa, lectin, agglutinin, single wavelength anomalous scattering phasing, Structural Genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, SUGAR BINDING PROTEIN
Deposited on 2002-03-15, released 2002-12-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PA-I galactophilic lectin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1l7la_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1l7lA (A:)
awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq
s