PDB entry 1l7i

View 1l7i on RCSB PDB site
Description: Crystal Structure of the anti-ErbB2 Fab2C4
Class: immune system
Keywords: Ig domain, Fab fragment, IMMUNE SYSTEM
Deposited on 2002-03-15, released 2002-07-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.197
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: chimera of Fab2C4: "humanized" murine monoclonal antibody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1l7ih1, d1l7ih2
  • Chain 'L':
    Compound: chimera of Fab2C4: "humanized" murine monoclonal antibody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1l7il1, d1l7il2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l7iH (H:)
    evqlvesggglvqpggslrlscaasgftftdytmdwvrqapgkglewvadvnpnsggsiy
    nqrfkgrftlsvdrskntlylqmnslraedtavyycarnlgpsfyfdywgqgtlvtvssa
    stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l7iL (L:)
    diqmtqspsslsasvgdrvtitckasqdvsigvawyqqkpgkapklliysasyrytgvps
    rfsgsgsgtdftltisslqpedfatyycqqyyiypytfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec