PDB entry 1l7i

View 1l7i on RCSB PDB site
Description: Crystal Structure of the anti-ErbB2 Fab2C4
Deposited on 2002-03-15, released 2002-07-10
The last revision prior to the SCOP 1.69 freeze date was dated 2002-07-10, with a file datestamp of 2002-07-10.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.197
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l7iH (H:)
    evqlvesggglvqpggslrlscaasgftftdytmdwvrqapgkglewvadvnpnsggsiy
    nqrfkgrftlsvdrskntlylqmnslraedtavyycarnlgpsfyfdywgqgtlvtvssa
    stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l7iL (L:)
    diqmtqspsslsasvgdrvtitckasqdvsigvawyqqkpgkapklliysasyrytgvps
    rfsgsgsgtdftltisslqpedfatyycqqyyiypytfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec