PDB entry 1l7g

View 1l7g on RCSB PDB site
Description: Crystal structure of E119G mutant influenza virus neuraminidase in complex with BCX-1812
Class: hydrolase
Keywords: neuraminidase, hydrolase, influenza, glycosylated protein, BCX-1812, E119G mutant
Deposited on 2002-03-15, released 2002-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.148
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03472 (0-387)
      • engineered (37)
    Domains in SCOPe 2.07: d1l7ga_
  • Heterogens: NAG, CA, BCZ, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l7gA (A:)
    rdfnnltkglctinswhiygkdnavrigedsdvlvtrgpyvscdpdecrfyalsqgttir
    gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnn
    asaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkeg
    kilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicsp
    vltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpn
    altddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
    nsivsmcssteflgqwdwpdgakieyfl