PDB entry 1l7e

View 1l7e on RCSB PDB site
Description: Crystal Structure of R. rubrum Transhydrogenase Domain I with Bound NADH
Class: oxidoreductase
Keywords: Transhydrogenase domain I with NADH bound, OXIDOREDUCTASE
Deposited on 2002-03-14, released 2002-11-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.251
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nicotinamide nucleotide Transhydrogenase, subunit alpha 1
    Species: Rhodospirillum rubrum [TaxId:1085]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1l7ea1, d1l7ea2
  • Chain 'B':
    Compound: nicotinamide nucleotide Transhydrogenase, subunit alpha 1
    Species: Rhodospirillum rubrum [TaxId:1085]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1l7eb1, d1l7eb2
  • Chain 'C':
    Compound: nicotinamide nucleotide Transhydrogenase, subunit alpha 1
    Species: Rhodospirillum rubrum [TaxId:1085]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1l7ec1, d1l7ec2
  • Chain 'D':
    Compound: nicotinamide nucleotide Transhydrogenase, subunit alpha 1
    Species: Rhodospirillum rubrum [TaxId:1085]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1l7ed1, d1l7ed2
  • Heterogens: NAI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l7eA (A:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvddeamktaetaggyakemg
    eefrkkqaeavlkelvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggn
    cplsepgkivvkhgvkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkled
    etvsgtcvtrdgaivhpaltgqga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l7eA (A:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvddetaggyakemgeefrkk
    qaeavlkelvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggncplsep
    gkivvkhgvkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkledetvsgt
    cvtrdgaivhpa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l7eB (B:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvddeamktaetaggyakemg
    eefrkkqaeavlkelvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggn
    cplsepgkivvkhgvkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkled
    etvsgtcvtrdgaivhpaltgqga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l7eB (B:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvrkkqaeavlkelvktdiai
    ttalipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtn
    vpsrvaadasplfaknllnfltphvdkdtktlvmkledetvsgtcvtrdgaivhpal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1l7eC (C:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvddeamktaetaggyakemg
    eefrkkqaeavlkelvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggn
    cplsepgkivvkhgvkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkled
    etvsgtcvtrdgaivhpaltgqga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l7eC (C:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfikqaeavlkelvktdiaittal
    ipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnvpsr
    vaadasplfaknllnfltphvdkdtktlvmkledetvsgtcvtrdgaivhpal
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1l7eD (D:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvddeamktaetaggyakemg
    eefrkkqaeavlkelvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggn
    cplsepgkivvkhgvkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkled
    etvsgtcvtrdgaivhpaltgqga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l7eD (D:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvdggyakemgeefrkkqaea
    vlkelvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkiv
    vkhgvkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkledetvsgtcvtr
    dgaivhp