PDB entry 1l7d

View 1l7d on RCSB PDB site
Description: Crystal Structure of R. rubrum Transhydrogenase Domain I without Bound NAD(H)
Deposited on 2002-03-14, released 2002-11-20
The last revision prior to the SCOP 1.63 freeze date was dated 2002-11-20, with a file datestamp of 2002-11-20.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.22
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l7dA (A:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvddeamktaetaggyakemg
    eefrkkqaeavlkelvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggn
    cplsepgkivvkhgvkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkled
    etvsgtcvtrdgaivhp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l7dA (A:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvkkqaeavlkelvktdiait
    talipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnv
    psrvaadasplfaknllnfltphvdkdtktlvmkledetvsgtcvtrdgaivhp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l7dB (B:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvddeamktaetaggyakemg
    eefrkkqaeavlkelvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggn
    cplsepgkivvkhgvkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkled
    etvsgtcvtrdgaivhpaltgqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l7dB (B:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitkqaeavlkelvktdiaitta
    lipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnvps
    rvaadasplfaknllnfltphvdkdtktlvmkledetvsgtcvtrdgaivhpaltgqg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1l7dC (C:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvddeamktaetaggyakemg
    eefrkkqaeavlkelvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggn
    cplsepgkivvkhgvkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkled
    etvsgtcvtrdgaivhpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l7dC (C:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvkkqaeavlkelvktdiait
    talipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnv
    psrvaadasplfaknllnfltphvdkdtktlvmkledetvsgtcvtrdgaivhpa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1l7dD (D:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvddeamktaetaggyakemg
    eefrkkqaeavlkelvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggn
    cplsepgkivvkhgvkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkled
    etvsgtcvtrdgaivhp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l7dD (D:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitkkqaeavlkelvktdiaitt
    alipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnvp
    srvaadasplfaknllnfltphvdkdtktlvmkledetvsgtcvtrdgaivhp