PDB entry 1l7b

View 1l7b on RCSB PDB site
Description: Solution NMR Structure of BRCT Domain of T. Thermophilus: Northeast Structural Genomics Consortium Target WR64TT
Class: ligase
Keywords: BRCT, DNA LIGASE, NMR, AUTOSTRUCTURE, STRUCTURAL GENOMICS, NESG, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium
Deposited on 2002-03-14, released 2003-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA ligase
    Species: Thermus thermophilus [TaxId:274]
    Gene: DNLJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26996 (1-89)
      • see remark 999 (0)
      • see remark 999 (90-91)
    Domains in SCOPe 2.07: d1l7ba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1l7bA (A:)
mekggealkgltfvitgelsrpreevkallrrlgakvtdsvsrktsylvvgenpgsklek
aralgvptlteeelyrlleartgkkaeelvgs