PDB entry 1l6y

View 1l6y on RCSB PDB site
Description: Crystal Structure of Porphobilinogen Synthase Complexed with the Inhibitor 4-Oxosebacic Acid
Deposited on 2002-03-14, released 2002-04-17
The last revision prior to the SCOP 1.65 freeze date was dated 2002-04-17, with a file datestamp of 2002-04-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.206
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1l6ya_
  • Chain 'B':
    Domains in SCOP 1.65: d1l6yb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l6yA (A:)
    tdliqrprrlrkspalramfeettlslndlvlpifveeeiddykaveampgvmripekhl
    areierianagirsvmtfgishhtdetgsdawredglvarmsrickqtvpemivmsdtcf
    ceytshghcgvlcehgvdndatlenlgkqavvaaaagadfiapsaamdgqvqairqalda
    agfkdtaimsystkfassfygpfreaagsalkgdrksyqmnpmnrreaireslldeaqga
    dclmvkpagayldivrelrertelpigayqvsgeyamikfaalagaideekvvleslgsi
    kragadlifsyfaldlaekkilr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l6yB (B:)
    tdliqrprrlrkspalramfeettlslndlvlpifveeeiddykaveampgvmripekhl
    areierianagirsvmtfgishhtdetgsdawredglvarmsrickqtvpemivmsdtcf
    ceytshghcgvlcehgvdndatlenlgkqavvaaaagadfiapsaamdgqvqairqalda
    agfkdtaimsystkfassfygpfreaagsalkgdrksyqmnpmnrreaireslldeaqga
    dclmvkpagayldivrelrertelpigayqvsgeyamikfaalagaideekvvleslgsi
    kragadlifsyfaldlaekkilr