SCOPe 2.07: Structural Classification of Proteins

PDB entry 1l6u

View 1l6u on RCSB PDB site
Description: nmr structure of oxidized adrenodoxin
Class: electron transport
Keywords: [2Fe-2S]-cluster, primary interaction domain (helix from Asp72-Asp79), (alpha-beta)-Protein, 5 Helices, 5 beta strands, ELECTRON TRANSPORT
Deposited on 2002-03-14, released 2002-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Adrenodoxin 1
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Uniprot P00257 (0-End)
Domains in SCOPe 2.07: d1l6ua_
Heterogens: FES

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1l6uA (A:)
sssedkitvhfinrdgetlttkgkigdslldvvvqnnldidgfgacegtlacstchlife
qhifekleaitdeendmldlaygltdrsrlgcqicltkamdnmtvrvpdavsdaresidm
gmnsskie

Sequence, based on observed residues (ATOM records): (download)

>1l6uA (A:)
sssedkitvhfinrdgetlttkgkigdslldvvvqnnldidgfgacegtlacstchlife
qhifekleaitdeendmldlaygltdrsrlgcqicltkamdnmtvrvp