PDB entry 1l6u

View 1l6u on RCSB PDB site
Description: nmr structure of oxidized adrenodoxin
Deposited on 2002-03-14, released 2002-06-26
The last revision prior to the SCOP 1.63 freeze date was dated 2002-06-26, with a file datestamp of 2002-06-26.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1l6ua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l6uA (A:)
    sssedkitvhfinrdgetlttkgkigdslldvvvqnnldidgfgacegtlacstchlife
    qhifekleaitdeendmldlaygltdrsrlgcqicltkamdnmtvrvp