PDB entry 1l6s

View 1l6s on RCSB PDB site
Description: Crystal Structure of Porphobilinogen Synthase Complexed with the Inhibitor 4,7-Dioxosebacic Acid
Class: lyase
Keywords: dehydratase, lyase
Deposited on 2002-03-13, released 2002-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.195
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: porphobilinogen synthase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACB2 (0-322)
      • modified residue (132)
    Domains in SCOPe 2.07: d1l6sa_
  • Chain 'B':
    Compound: porphobilinogen synthase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACB2 (0-322)
      • modified residue (132)
    Domains in SCOPe 2.07: d1l6sb_
  • Heterogens: ZN, MG, DSB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l6sA (A:)
    tdliqrprrlrkspalramfeettlslndlvlpifveeeiddykaveampgvmripekhl
    areierianagirsvmtfgishhtdetgsdawredglvarmsrickqtvpemivmsdtcf
    ceytshghcgvlcehgvdndatlenlgkqavvaaaagadfiapsaamdgqvqairqalda
    agfkdtaimsystkfassfygpfreaagsalkgdrksyqmnpmnrreaireslldeaqga
    dclmvkpagayldivrelrertelpigayqvsgeyamikfaalagaideekvvleslgsi
    kragadlifsyfaldlaekkilr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l6sB (B:)
    tdliqrprrlrkspalramfeettlslndlvlpifveeeiddykaveampgvmripekhl
    areierianagirsvmtfgishhtdetgsdawredglvarmsrickqtvpemivmsdtcf
    ceytshghcgvlcehgvdndatlenlgkqavvaaaagadfiapsaamdgqvqairqalda
    agfkdtaimsystkfassfygpfreaagsalkgdrksyqmnpmnrreaireslldeaqga
    dclmvkpagayldivrelrertelpigayqvsgeyamikfaalagaideekvvleslgsi
    kragadlifsyfaldlaekkilr