PDB entry 1l6r

View 1l6r on RCSB PDB site
Description: Crystal Structure of Thermoplasma acidophilum 0175 (APC0014)
Class: structural genomics, unknown function
Keywords: Structural Genomics, Hypothetical protein, putative hydroLase, Midwest Center for Structural Genomics, MCSG, PSI, Protein Structure Initiative, UNKNOWN FUNCTION
Deposited on 2002-03-13, released 2003-01-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TA0175
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: TA0175
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HLQ2 (3-226)
      • cloning artifact (2)
      • engineered (14)
    Domains in SCOPe 2.08: d1l6ra1, d1l6ra2
  • Chain 'B':
    Compound: hypothetical protein TA0175
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: TA0175
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HLQ2 (3-226)
      • cloning artifact (2)
      • engineered (14)
    Domains in SCOPe 2.08: d1l6rb1, d1l6rb2
  • Heterogens: CA, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l6rA (A:)
    gshmirlaaidvdgnltdrdrlistkaiesirsaekkgltvsllsgnvipvvyalkiflg
    ingpvfgenggimfdndgsikkffsnegtnkfleemskrtsmrsiltnrwreastgfdid
    pedvdyvrkeaesrgfvifysgyswhlmnrgedkafavnklkemysleydeilvigdsnn
    dmpmfqlpvrkacpanatdnikavsdfvsdysygeeigqifkhfelm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l6rA (A:)
    hmirlaaidvdgnltdrdrlistkaiesirsaekkgltvsllsgnvipvvyalkiflgin
    gpvfgenggimfdndgsikkffsnegtnkfleemskrtsmrsiltnrwreastgfdidpe
    dvdyvrkeaesrgfvifysgyswhlmnrgedkafavnklkemysleydeilvigdsnndm
    pmfqlpvrkacpanatdnikavsdfvsdysygeeigqifkhfelm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l6rB (B:)
    gshmirlaaidvdgnltdrdrlistkaiesirsaekkgltvsllsgnvipvvyalkiflg
    ingpvfgenggimfdndgsikkffsnegtnkfleemskrtsmrsiltnrwreastgfdid
    pedvdyvrkeaesrgfvifysgyswhlmnrgedkafavnklkemysleydeilvigdsnn
    dmpmfqlpvrkacpanatdnikavsdfvsdysygeeigqifkhfelm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l6rB (B:)
    hmirlaaidvdgnltdrdrlistkaiesirsaekkgltvsllsgnvipvvyalkiflgin
    gpvfgenggimfdndgsikkffsnegtnkfleemskrtsmrsiltnrwreastgfdidpe
    dvdyvrkeaesrgfvifysgyswhlmnrgedkafavnklkemysleydeilvigdsnndm
    pmfqlpvrkacpanatdnikavsdfvsdysygeeigqifkhfelm