PDB entry 1l6o

View 1l6o on RCSB PDB site
Description: xenopus dishevelled pdz domain
Class: gene regulation
Keywords: dishevelled, Wnt pathway, PDZ, molecular recognition, GENE REGULATION
Deposited on 2002-03-11, released 2003-06-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.279
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Segment polarity protein dishevelled homolog DVL-2
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51142 (1-89)
      • see remark 999 (0)
      • modified residue (8)
      • modified residue (36)
      • modified residue (52)
      • modified residue (64)
      • expression tag (90-94)
    Domains in SCOPe 2.05: d1l6oa_
  • Chain 'B':
    Compound: Segment polarity protein dishevelled homolog DVL-2
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51142 (1-89)
      • see remark 999 (0)
      • modified residue (8)
      • modified residue (36)
      • modified residue (52)
      • modified residue (64)
      • expression tag (90-92)
    Domains in SCOPe 2.05: d1l6ob_
  • Chain 'C':
    Compound: Segment polarity protein dishevelled homolog DVL-2
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51142 (1-89)
      • see remark 999 (0)
      • modified residue (8)
      • modified residue (36)
      • modified residue (52)
      • modified residue (64)
      • expression tag (90-91)
    Domains in SCOPe 2.05: d1l6oc_
  • Chain 'D':
    Compound: Dapper 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB AAM12548 (0-7)
  • Chain 'E':
    Compound: Dapper 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB AAM12548 (0-7)
  • Chain 'F':
    Compound: Dapper 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB AAM12548 (0-7)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l6oA (A:)
    miitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndi
    nfenmsnddavrvlrdivhkpgpivltvaklehhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l6oB (B:)
    miitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndi
    nfenmsnddavrvlrdivhkpgpivltvaklehhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l6oB (B:)
    miitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndi
    nfenmsnddavrvlrdivhkpgpivltvakleh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1l6oC (C:)
    miitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndi
    nfenmsnddavrvlrdivhkpgpivltvaklehhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l6oC (C:)
    miitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndi
    nfenmsnddavrvlrdivhkpgpivltvakle
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.