PDB entry 1l6n

View 1l6n on RCSB PDB site
Description: structure of the n-terminal 283-residue fragment of the hiv-1 gag polyprotein
Class: Viral protein
Keywords: gag, matrix, capsid, maturation, Viral protein
Deposited on 2002-03-11, released 2002-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gag polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72497 (Start-282)
      • expression tag (283-288)
    Domains in SCOPe 2.07: d1l6na1, d1l6na2, d1l6na3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l6nA (A:)
    mgarasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqi
    lgqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaaa
    dtgnnsqvsqnypivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegat
    pqdlntmlntvgghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagtt
    stlqeqigwmthnppipvgeiykrwiilglnkivrmysptsilhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l6nA (A:)
    garasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqil
    gqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaaad
    tgnnsqvsqnypivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatp
    qdlntmlntvgghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagtts
    tlqeqigwmthnppipvgeiykrwiilglnkivrmysptsilhhhhhh