PDB entry 1l6m

View 1l6m on RCSB PDB site
Description: Neutrophil Gelatinase-associated Lipocalin is a Novel Bacteriostatic Agent that Interferes with Siderophore-mediated Iron Acquisition
Class: transport protein
Keywords: lipocalin, siderophore
Deposited on 2002-03-11, released 2003-03-11
The last revision prior to the SCOP 1.73 freeze date was dated 2003-03-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.234
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neutrophil gelatinase-associated lipocalin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80188
      • engineered (88)
    Domains in SCOP 1.73: d1l6ma_
  • Chain 'B':
    Compound: Neutrophil gelatinase-associated lipocalin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80188
      • engineered (88)
    Domains in SCOP 1.73: d1l6mb_
  • Chain 'C':
    Compound: Neutrophil gelatinase-associated lipocalin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80188
      • engineered (88)
    Domains in SCOP 1.73: d1l6mc_
  • Heterogens: FE, SO4, DBH, DBS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l6mA (A:)
    gsqdstsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyel
    kedksynvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqh
    amvffkkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l6mA (A:)
    tsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedks
    ynvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvff
    kkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l6mB (B:)
    gsqdstsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyel
    kedksynvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqh
    amvffkkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l6mB (B:)
    tsdlipapplskvplqqnfqdnqfqgkwyvvglagnailrpqkmyatiyelkedksynvt
    svlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffkkvs
    qnreyfkitlygrtkeltelkenfirfskslglpenhivfpvpidqcid
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1l6mC (C:)
    gsqdstsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyel
    kedksynvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqh
    amvffkkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l6mC (C:)
    sdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedksy
    nvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffk
    kvsqnreyfkitlygrtketselkenfirfskslglpenhivfpvpidqcid