PDB entry 1l6j

View 1l6j on RCSB PDB site
Description: Crystal structure of human matrix metalloproteinase MMP9 (gelatinase B).
Class: hydrolase
Keywords: Twisted beta sheet flanked by helices
Deposited on 2002-03-11, released 2002-07-03
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.187
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Matrix metalloproteinase-9
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1l6ja1, d1l6ja2, d1l6ja3, d1l6ja4, d1l6ja5
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l6jA (A:)
    aprqrqstlvlfpgdlrtnltdrqlaeeylyrygytrvaemrgeskslgpallllqkqls
    lpetgeldsatlkamrtprcgvpdlgrfqtfegdlkwhhhnitywiqnysedlpravidd
    afarafalwsavtpltftrvysrdadiviqfgvaehgdgypfdgkdgllahafppgpgiq
    gdahfdddelwslgkgvvvptrfgnadgaachfpfifegrsysacttdgrsdglpwcstt
    anydtddrfgfcpserlytrdgnadgkpcqfpfifqgqsysacttdgrsdgyrwcattan
    ydrdklfgfcptradstvmggnsagelcvfpftflgkeystctsegrgdgrlwcattsnf
    dsdkkwgfcpdqgyslflvaahefghalgldhssvpealmypmyrftegpplhkddvngi
    rhlyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l6jA (A:)
    vlfpgdlrtnltdrqlaeeylyrygytlgpallllqkqlslpetgeldsatlkamrtprc
    gvpdlgrfqtfegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrv
    ysrdadiviqfgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgvvvp
    trfgnadgaachfpfifegrsysacttdgrsdglpwcsttanydtddrfgfcpserlytr
    dgnadgkpcqfpfifqgqsysacttdgrsdgyrwcattanydrdklfgfcptradstvmg
    gnsagelcvfpftflgkeystctsegrgdgrlwcattsnfdsdkkwgfcpdqgyslflva
    ahefghalgldhssvpealmypmyrftegpplhkddvngirhlyg