PDB entry 1l6i

View 1l6i on RCSB PDB site
Description: Crystal Structure of the Maltodextrin Phosphorylase complexed with the products of the enzymatic reaction between glucose-1-phosphate and maltopentaose
Class: transferase
Keywords: phosphorylase, enzymatic catalysis, substrate complex, TRANSFERASE
Deposited on 2002-03-11, released 2002-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maltodextrin phosphorylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • GB AAA58215 (0-795)
      • see remark 999 (260-262)
    Domains in SCOPe 2.08: d1l6ia_
  • Chain 'B':
    Compound: maltodextrin phosphorylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • GB AAA58215 (0-795)
      • see remark 999 (260-262)
    Domains in SCOPe 2.08: d1l6ib_
  • Heterogens: PO4, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l6iA (A:)
    sqpifndkqfqealsrqwqryglnsaaemtprqwwlavsealaemlraqpfakpvanqrh
    vnyismefligrltgnnllnlgwyqdvqdslkaydinltdlleeeidpalgngglgrlaa
    cfldsmatvgqsatgyglnyqyglfrqsfvdgkqveapddwhrsnypwfrhnealdvqvg
    iggkvtkdgrwepeftitgqawdlpvvgyrngvaqplrlwqathahpfdltkfndgdflr
    aeqqginaekltkvlypndnafegkklrlmqqyfqcacsvadilrrhhlagrklhelady
    eviqlndthptiaipellrvlidehqmswddawaitsktfaytnhtlmpealerwdvklv
    kgllprhmqiineintrfktlvektwpgdekvwaklavvhdkqvhmanlcvvggfavngv
    aalhsdlvvkdlfpeyhqlwpnkfhnvtngitprrwikqcnpalaalldkslqkewandl
    dqlinlekfaddakfrqqyreikqankvrlaefvkvrtgieinpqaifdiqikrlheykr
    qhlnllhilalykeirenpqadrvprvflfgakaapgyylakniifainkvadvinndpl
    vgdklkvvflpdycvsaaeklipaadiseqistagkeasgtgnmklalngaltvgtldga
    nveiaekvgeenififghtveqvkailakgydpvkwrkkdkvldavlkelesgkysdgdk
    hafdqmlhsigkqggdpylvmadfaayveaqkqvdvlyrdqeawtraailntarcgmfss
    drsirdyqariwqakr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l6iB (B:)
    sqpifndkqfqealsrqwqryglnsaaemtprqwwlavsealaemlraqpfakpvanqrh
    vnyismefligrltgnnllnlgwyqdvqdslkaydinltdlleeeidpalgngglgrlaa
    cfldsmatvgqsatgyglnyqyglfrqsfvdgkqveapddwhrsnypwfrhnealdvqvg
    iggkvtkdgrwepeftitgqawdlpvvgyrngvaqplrlwqathahpfdltkfndgdflr
    aeqqginaekltkvlypndnafegkklrlmqqyfqcacsvadilrrhhlagrklhelady
    eviqlndthptiaipellrvlidehqmswddawaitsktfaytnhtlmpealerwdvklv
    kgllprhmqiineintrfktlvektwpgdekvwaklavvhdkqvhmanlcvvggfavngv
    aalhsdlvvkdlfpeyhqlwpnkfhnvtngitprrwikqcnpalaalldkslqkewandl
    dqlinlekfaddakfrqqyreikqankvrlaefvkvrtgieinpqaifdiqikrlheykr
    qhlnllhilalykeirenpqadrvprvflfgakaapgyylakniifainkvadvinndpl
    vgdklkvvflpdycvsaaeklipaadiseqistagkeasgtgnmklalngaltvgtldga
    nveiaekvgeenififghtveqvkailakgydpvkwrkkdkvldavlkelesgkysdgdk
    hafdqmlhsigkqggdpylvmadfaayveaqkqvdvlyrdqeawtraailntarcgmfss
    drsirdyqariwqakr