PDB entry 1l6h

View 1l6h on RCSB PDB site
Description: Solution Structure of Plant nsLTP2 purified from Rice (oryza Sativa)
Class: lipid transport
Keywords: nsLTP2, Plant LTP, lipid transfer, LIPID TRANSPORT
Deposited on 2002-03-11, released 2002-10-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: non-specific lipid transfer protein
    Species: Oryza sativa [TaxId:4530]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1l6ha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l6hA (A:)
    agcnagqltvctgaiaggarptaaccsslraqqgcfcqfakdprygryvnspnarkavss
    cgialptch