PDB entry 1l6f

View 1l6f on RCSB PDB site
Description: Alanine racemase bound with N-(5'-phosphopyridoxyl)-L-alanine
Class: isomerase
Keywords: alanine racemase, reaction mechanism, N-(5'-phosphopyridoxyl)-alanine, ISOMERASE
Deposited on 2002-03-09, released 2002-06-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.172
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alanine racemase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10724
      • modified residue (128)
    Domains in SCOPe 2.06: d1l6fa1, d1l6fa2
  • Chain 'B':
    Compound: alanine racemase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10724
      • modified residue (128)
    Domains in SCOPe 2.06: d1l6fb1, d1l6fb2
  • Heterogens: PP3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l6fA (A:)
    mndfhrdtwaevdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagas
    rlavafldealalrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysg
    pfpihfhlkmdtgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsy
    qytrflhmlewlpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpyp
    lkeafslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlqhfhvlvd
    gqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletinyevpcti
    syrvpriffrhkrimevrnaigrgessa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l6fA (A:)
    ndfhrdtwaevdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasr
    lavafldealalrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgp
    fpihfhlkmdtgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyq
    ytrflhmlewlpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpypl
    keafslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlqhfhvlvdg
    qkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletinyevpctis
    yrvpriffrhkrimevrnaigr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l6fB (B:)
    mndfhrdtwaevdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagas
    rlavafldealalrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysg
    pfpihfhlkmdtgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsy
    qytrflhmlewlpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpyp
    lkeafslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlqhfhvlvd
    gqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletinyevpcti
    syrvpriffrhkrimevrnaigrgessa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l6fB (B:)
    ndfhrdtwaevdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasr
    lavafldealalrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgp
    fpihfhlkmdtgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyq
    ytrflhmlewlpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpypl
    keafslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlqhfhvlvdg
    qkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletinyevpctis
    yrvpriffrhkrimevrnaigr