PDB entry 1l6e

View 1l6e on RCSB PDB site
Description: Solution structure of the docking and dimerization domain of protein kinase A II-alpha (RIIalpha D/D). Alternatively called the N-terminal dimerization domain of the regulatory subunit of protein kinase A.
Class: transferase
Keywords: Four-helix bundle, helix-loop-helix, regulatory subunit, dimerization, docking, anchoring
Deposited on 2002-03-08, released 2002-04-03
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR24
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase Type II-alpha regulatory chain
    Species: MUS MUSCULUS
    Gene: RIIA(1-44)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12367 (3-45)
      • see remark 999 (0-2)
      • variant (23)
    Domains in SCOP 1.73: d1l6ea_
  • Chain 'B':
    Compound: cAMP-dependent protein kinase Type II-alpha regulatory chain
    Species: MUS MUSCULUS
    Gene: RIIA(1-44)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12367 (3-45)
      • see remark 999 (0-2)
      • variant (23)
    Domains in SCOP 1.73: d1l6eb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l6eA (A:)
    hmghiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l6eB (B:)
    hmghiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr