PDB entry 1l68

View 1l68 on RCSB PDB site
Description: tolerance of t4 lysozyme to multiple xaa (right arrow) ala substitutions: a polyalanine alpha-helix containing ten consecutive alanines
Deposited on 1991-09-23, released 1991-10-15
The last revision prior to the SCOP 1.59 freeze date was dated 1991-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.165
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.59: d1l68__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1l68_ (-)
  mnifemlrideglrlkiykdtegyytigighlltkspslnaakaeldkaigrntngvitk
  deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
  lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk