PDB entry 1l5r

View 1l5r on RCSB PDB site
Description: human liver glycogen phosphorylase a complexed with riboflavin, n- acetyl-beta-d-glucopyranosylamine and cp-403,700
Deposited on 2002-03-07, released 2002-12-04
The last revision prior to the SCOP 1.67 freeze date was dated 2002-12-04, with a file datestamp of 2002-12-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.247
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1l5ra_
  • Chain 'B':
    Domains in SCOP 1.67: d1l5rb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l5rA (A:)
    makpltdqekrrqisirgivgvenvaelkksfnrhlhftlvkdrnvattrdyyfalahtv
    rdhlvgrwirtqqhyydkcpkrvyylslefymgrtlqntminlglqnacdeaiyqlgldi
    eeleeieedaglgngglgrlaacfldsmatlglaaygygiryeygifnqkirdgwqveea
    ddwlrygnpweksrpefmlpvhfygkvehtntgtkwidtqvvlalpydtpvpgymnntvn
    tmrlwsarapndfnlrdfnvgdyiqavldrnlaenisrvlypndnffegkelrlkqeyfv
    vaatlqdiirrfkaskfgstrgagtvfdafpdqvaiqlndthpalaipelmrifvdiekl
    pwskaweltqktfaytnhtvlpealerwpvdlvekllprhleiiyeinqkhldrivalfp
    kdvdrlrrmslieeegskrinmahlcivgshavngvakihsdivktkvfkdfselepdkf
    qnktngitprrwlllcnpglaeliaekigedyvkdlsqltklhsflgddvflrelakvkq
    enklkfsqfleteykvkinpssmfdvqvkriheykrqllnclhvitmynrikkdpkklfv
    prtviiggkaapgyhmakmiiklitsvadvvnndpmvgsklkviflenyrvslaekvipa
    tdlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenlfifgmriddva
    aldkkgyeakeyyealpelklvidqidngffspkqpdlfkdiinmlfyhdrfkvfadyea
    yvkcqdkvsqlymnpkawntmvlkniaasgkfssdrtikeyaqniwnvepsdlkislsne
    snkvngn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l5rA (A:)
    envaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkr
    vyylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaa
    cfldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvh
    fygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapndyiqavldrnl
    aenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskfvfdafpdqvaiqlnd
    thpalaipelmrifvdieklpwskaweltqktfaytnhtvlpealerwpvdlvekllprh
    leiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinmahlcivgshavngvakih
    sdivktkvfkdfselepdkfqnktngitprrwlllcnpglaeliaekigedyvkdlsqlt
    klhsflgddvflrelakvkqenklkfsqfleteykvkinpssmfdvqvkriheykrqlln
    clhvitmynrikkdpkklfvprtviiggkaapgyhmakmiiklitsvadvvnndpmvgsk
    lkviflenyrvslaekvipatdlseqistagteasgtgnmkfmlngaltigtmdganvem
    aeeageenlfifgmriddvaaldkkgyeakeyyealpelklvidqidngffspkqpdlfk
    diinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvlkniaasgkfssdrtike
    yaqniwnvep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l5rB (B:)
    makpltdqekrrqisirgivgvenvaelkksfnrhlhftlvkdrnvattrdyyfalahtv
    rdhlvgrwirtqqhyydkcpkrvyylslefymgrtlqntminlglqnacdeaiyqlgldi
    eeleeieedaglgngglgrlaacfldsmatlglaaygygiryeygifnqkirdgwqveea
    ddwlrygnpweksrpefmlpvhfygkvehtntgtkwidtqvvlalpydtpvpgymnntvn
    tmrlwsarapndfnlrdfnvgdyiqavldrnlaenisrvlypndnffegkelrlkqeyfv
    vaatlqdiirrfkaskfgstrgagtvfdafpdqvaiqlndthpalaipelmrifvdiekl
    pwskaweltqktfaytnhtvlpealerwpvdlvekllprhleiiyeinqkhldrivalfp
    kdvdrlrrmslieeegskrinmahlcivgshavngvakihsdivktkvfkdfselepdkf
    qnktngitprrwlllcnpglaeliaekigedyvkdlsqltklhsflgddvflrelakvkq
    enklkfsqfleteykvkinpssmfdvqvkriheykrqllnclhvitmynrikkdpkklfv
    prtviiggkaapgyhmakmiiklitsvadvvnndpmvgsklkviflenyrvslaekvipa
    tdlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenlfifgmriddva
    aldkkgyeakeyyealpelklvidqidngffspkqpdlfkdiinmlfyhdrfkvfadyea
    yvkcqdkvsqlymnpkawntmvlkniaasgkfssdrtikeyaqniwnvepsdlkislsne
    snkvngn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l5rB (B:)
    envaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkr
    vyylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaa
    cfldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvh
    fygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapndyiqavldrnl
    aenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskfvfdafpdqvaiqlnd
    thpalaipelmrifvdieklpwskaweltqktfaytnhtvlpealerwpvdlvekllprh
    leiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinmahlcivgshavngvakih
    sdivktkvfkdfselepdkfqnktngitprrwlllcnpglaeliaekigedyvkdlsqlt
    klhsflgddvflrelakvkqenklkfsqfleteykvkinpssmfdvqvkriheykrqlln
    clhvitmynrikkdpkklfvprtviiggkaapgyhmakmiiklitsvadvvnndpmvgsk
    lkviflenyrvslaekvipatdlseqistagteasgtgnmkfmlngaltigtmdganvem
    aeeageenlfifgmriddvaaldkkgyeakeyyealpelklvidqidngffspkqpdlfk
    diinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvlkniaasgkfssdrtike
    yaqniwnveps