PDB entry 1l5r

View 1l5r on RCSB PDB site
Description: Human liver glycogen phosphorylase a complexed with riboflavin, N-Acetyl-beta-D-Glucopyranosylamine and CP-403,700
Class: transferase
Keywords: phosphorylase, purine site, TRANSFERASE
Deposited on 2002-03-07, released 2002-12-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, liver form
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1l5ra_
  • Chain 'B':
    Compound: Glycogen phosphorylase, liver form
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1l5rb_
  • Heterogens: NBG, PLP, 700, RBF, MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l5rA (A:)
    makpltdqekrrqisirgivgvenvaelkksfnrhlhftlvkdrnvattrdyyfalahtv
    rdhlvgrwirtqqhyydkcpkrvyylslefymgrtlqntminlglqnacdeaiyqlgldi
    eeleeieedaglgngglgrlaacfldsmatlglaaygygiryeygifnqkirdgwqveea
    ddwlrygnpweksrpefmlpvhfygkvehtntgtkwidtqvvlalpydtpvpgymnntvn
    tmrlwsarapndfnlrdfnvgdyiqavldrnlaenisrvlypndnffegkelrlkqeyfv
    vaatlqdiirrfkaskfgstrgagtvfdafpdqvaiqlndthpalaipelmrifvdiekl
    pwskaweltqktfaytnhtvlpealerwpvdlvekllprhleiiyeinqkhldrivalfp
    kdvdrlrrmslieeegskrinmahlcivgshavngvakihsdivktkvfkdfselepdkf
    qnktngitprrwlllcnpglaeliaekigedyvkdlsqltklhsflgddvflrelakvkq
    enklkfsqfleteykvkinpssmfdvqvkriheykrqllnclhvitmynrikkdpkklfv
    prtviiggkaapgyhmakmiiklitsvadvvnndpmvgsklkviflenyrvslaekvipa
    tdlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenlfifgmriddva
    aldkkgyeakeyyealpelklvidqidngffspkqpdlfkdiinmlfyhdrfkvfadyea
    yvkcqdkvsqlymnpkawntmvlkniaasgkfssdrtikeyaqniwnvepsdlkislsne
    snkvngn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l5rA (A:)
    envaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkr
    vyylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaa
    cfldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvh
    fygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapndyiqavldrnl
    aenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskfvfdafpdqvaiqlnd
    thpalaipelmrifvdieklpwskaweltqktfaytnhtvlpealerwpvdlvekllprh
    leiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinmahlcivgshavngvakih
    sdivktkvfkdfselepdkfqnktngitprrwlllcnpglaeliaekigedyvkdlsqlt
    klhsflgddvflrelakvkqenklkfsqfleteykvkinpssmfdvqvkriheykrqlln
    clhvitmynrikkdpkklfvprtviiggkaapgyhmakmiiklitsvadvvnndpmvgsk
    lkviflenyrvslaekvipatdlseqistagteasgtgnmkfmlngaltigtmdganvem
    aeeageenlfifgmriddvaaldkkgyeakeyyealpelklvidqidngffspkqpdlfk
    diinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvlkniaasgkfssdrtike
    yaqniwnvep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l5rB (B:)
    makpltdqekrrqisirgivgvenvaelkksfnrhlhftlvkdrnvattrdyyfalahtv
    rdhlvgrwirtqqhyydkcpkrvyylslefymgrtlqntminlglqnacdeaiyqlgldi
    eeleeieedaglgngglgrlaacfldsmatlglaaygygiryeygifnqkirdgwqveea
    ddwlrygnpweksrpefmlpvhfygkvehtntgtkwidtqvvlalpydtpvpgymnntvn
    tmrlwsarapndfnlrdfnvgdyiqavldrnlaenisrvlypndnffegkelrlkqeyfv
    vaatlqdiirrfkaskfgstrgagtvfdafpdqvaiqlndthpalaipelmrifvdiekl
    pwskaweltqktfaytnhtvlpealerwpvdlvekllprhleiiyeinqkhldrivalfp
    kdvdrlrrmslieeegskrinmahlcivgshavngvakihsdivktkvfkdfselepdkf
    qnktngitprrwlllcnpglaeliaekigedyvkdlsqltklhsflgddvflrelakvkq
    enklkfsqfleteykvkinpssmfdvqvkriheykrqllnclhvitmynrikkdpkklfv
    prtviiggkaapgyhmakmiiklitsvadvvnndpmvgsklkviflenyrvslaekvipa
    tdlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenlfifgmriddva
    aldkkgyeakeyyealpelklvidqidngffspkqpdlfkdiinmlfyhdrfkvfadyea
    yvkcqdkvsqlymnpkawntmvlkniaasgkfssdrtikeyaqniwnvepsdlkislsne
    snkvngn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l5rB (B:)
    envaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkr
    vyylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaa
    cfldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvh
    fygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapndyiqavldrnl
    aenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskfvfdafpdqvaiqlnd
    thpalaipelmrifvdieklpwskaweltqktfaytnhtvlpealerwpvdlvekllprh
    leiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinmahlcivgshavngvakih
    sdivktkvfkdfselepdkfqnktngitprrwlllcnpglaeliaekigedyvkdlsqlt
    klhsflgddvflrelakvkqenklkfsqfleteykvkinpssmfdvqvkriheykrqlln
    clhvitmynrikkdpkklfvprtviiggkaapgyhmakmiiklitsvadvvnndpmvgsk
    lkviflenyrvslaekvipatdlseqistagteasgtgnmkfmlngaltigtmdganvem
    aeeageenlfifgmriddvaaldkkgyeakeyyealpelklvidqidngffspkqpdlfk
    diinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvlkniaasgkfssdrtike
    yaqniwnveps