PDB entry 1l5q

View 1l5q on RCSB PDB site
Description: Human liver glycogen phosphorylase a complexed with caffeine, N-Acetyl-beta-D-glucopyranosylamine, and CP-403700
Class: transferase
Keywords: phosphorylase, purine site, TRANSFERASE
Deposited on 2002-03-07, released 2002-12-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.207
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, liver form
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l5qa_
  • Chain 'B':
    Compound: Glycogen phosphorylase, liver form
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l5qb_
  • Heterogens: NBG, PLP, 700, CFF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l5qA (A:)
    makpltdqekrrqisirgivgvenvaelkksfnrhlhftlvkdrnvattrdyyfalahtv
    rdhlvgrwirtqqhyydkcpkrvyylslefymgrtlqntminlglqnacdeaiyqlgldi
    eeleeieedaglgngglgrlaacfldsmatlglaaygygiryeygifnqkirdgwqveea
    ddwlrygnpweksrpefmlpvhfygkvehtntgtkwidtqvvlalpydtpvpgymnntvn
    tmrlwsarapndfnlrdfnvgdyiqavldrnlaenisrvlypndnffegkelrlkqeyfv
    vaatlqdiirrfkaskfgstrgagtvfdafpdqvaiqlndthpalaipelmrifvdiekl
    pwskaweltqktfaytnhtvlpealerwpvdlvekllprhleiiyeinqkhldrivalfp
    kdvdrlrrmslieeegskrinmahlcivgshavngvakihsdivktkvfkdfselepdkf
    qnktngitprrwlllcnpglaeliaekigedyvkdlsqltklhsflgddvflrelakvkq
    enklkfsqfleteykvkinpssmfdvqvkriheykrqllnclhvitmynrikkdpkklfv
    prtviiggkaapgyhmakmiiklitsvadvvnndpmvgsklkviflenyrvslaekvipa
    tdlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenlfifgmriddva
    aldkkgyeakeyyealpelklvidqidngffspkqpdlfkdiinmlfyhdrfkvfadyea
    yvkcqdkvsqlymnpkawntmvlkniaasgkfssdrtikeyaqniwnvepsdlkislsne
    snkvngn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l5qA (A:)
    envaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkr
    vyylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaa
    cfldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvh
    fygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapndyiqavldrnl
    aenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskfvfdafpdqvaiqlnd
    thpalaipelmrifvdieklpwskaweltqktfaytnhtvlpealerwpvdlvekllprh
    leiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinmahlcivgshavngvakih
    sdivktkvfkdfselepdkfqnktngitprrwlllcnpglaeliaekigedyvkdlsqlt
    klhsflgddvflrelakvkqenklkfsqfleteykvkinpssmfdvqvkriheykrqlln
    clhvitmynrikkdpkklfvprtviiggkaapgyhmakmiiklitsvadvvnndpmvgsk
    lkviflenyrvslaekvipatdlseqistagteasgtgnmkfmlngaltigtmdganvem
    aeeageenlfifgmriddvaaldkkgyeakeyyealpelklvidqidngffspkqpdlfk
    diinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvlkniaasgkfssdrtike
    yaqniwnveps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l5qB (B:)
    makpltdqekrrqisirgivgvenvaelkksfnrhlhftlvkdrnvattrdyyfalahtv
    rdhlvgrwirtqqhyydkcpkrvyylslefymgrtlqntminlglqnacdeaiyqlgldi
    eeleeieedaglgngglgrlaacfldsmatlglaaygygiryeygifnqkirdgwqveea
    ddwlrygnpweksrpefmlpvhfygkvehtntgtkwidtqvvlalpydtpvpgymnntvn
    tmrlwsarapndfnlrdfnvgdyiqavldrnlaenisrvlypndnffegkelrlkqeyfv
    vaatlqdiirrfkaskfgstrgagtvfdafpdqvaiqlndthpalaipelmrifvdiekl
    pwskaweltqktfaytnhtvlpealerwpvdlvekllprhleiiyeinqkhldrivalfp
    kdvdrlrrmslieeegskrinmahlcivgshavngvakihsdivktkvfkdfselepdkf
    qnktngitprrwlllcnpglaeliaekigedyvkdlsqltklhsflgddvflrelakvkq
    enklkfsqfleteykvkinpssmfdvqvkriheykrqllnclhvitmynrikkdpkklfv
    prtviiggkaapgyhmakmiiklitsvadvvnndpmvgsklkviflenyrvslaekvipa
    tdlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenlfifgmriddva
    aldkkgyeakeyyealpelklvidqidngffspkqpdlfkdiinmlfyhdrfkvfadyea
    yvkcqdkvsqlymnpkawntmvlkniaasgkfssdrtikeyaqniwnvepsdlkislsne
    snkvngn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l5qB (B:)
    nvaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkrv
    yylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaac
    fldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvhf
    ygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapndyiqavldrnla
    enisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskfvfdafpdqvaiqlndt
    hpalaipelmrifvdieklpwskaweltqktfaytnhtvlpealerwpvdlvekllprhl
    eiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinmahlcivgshavngvakihs
    divktkvfkdfselepdkfqnktngitprrwlllcnpglaeliaekigedyvkdlsqltk
    lhsflgddvflrelakvkqenklkfsqfleteykvkinpssmfdvqvkriheykrqllnc
    lhvitmynrikkdpkklfvprtviiggkaapgyhmakmiiklitsvadvvnndpmvgskl
    kviflenyrvslaekvipatdlseqistagteasgtgnmkfmlngaltigtmdganvema
    eeageenlfifgmriddvaaldkkgyeakeyyealpelklvidqidngffspkqpdlfkd
    iinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvlkniaasgkfssdrtikey
    aqniwnveps