PDB entry 1l5j

View 1l5j on RCSB PDB site
Description: crystal structure of e. coli aconitase b.
Class: lyase
Keywords: Molecular recognition, RNA binding, Citric acid cycle, HEAT-like domain, LYASE
Deposited on 2002-03-07, released 2002-06-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.154
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aconitate hydratase 2
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1l5ja1, d1l5ja2, d1l5ja3
  • Chain 'B':
    Compound: Aconitate hydratase 2
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1l5jb1, d1l5jb2, d1l5jb3
  • Heterogens: TRA, F3S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l5jA (A:)
    mleeyrkhvaeraaegiapkpldanqmaalvellknppageeeflldlltnrvppgvdea
    ayvkagflaaiakgeaksplltpekaiellgtmqggynihplidalddaklapiaakals
    htllmfdnfydveekakagneyakqvmqswadaewflnrpalaekltvtvfkvtgetntd
    dlspapdawsrpdiplhalamlknaregiepdqpgvvgpikqiealqqkgfplayvgdvv
    gtgssrksatnsvlwfmgddiphvpnkrggglclggkiapiffntmedagalpievdvsn
    lnmgdvidvypykgevrnhetgellatfelktdvlidevraggripliigrglttkarea
    lglphsdvfrqakdvaesdrgfslaqkmvgracgvkgirpgaycepkmtsvgsqdttgpm
    trdelkdlaclgfsadlvmqsfchtaaypkpvdvnthhtlpdfimnrggvslrpgdgvih
    swlnrmllpdtvgtggdshtrfpigisfpagsglvafaaatgvmpldmpesvlvrfkgkm
    qpgitlrdlvhaiplyaikqglltvekkgkknifsgrileieglpdlkveqafeltdasa
    ersaagctiklnkepiieylnsnivllkwmiaegygdrrtlerriqgmekwlanpellea
    dadaeyaavididladikepilcapndpddarplsavqgekidevfigscmtnighfraa
    gklldahkgqlptrlwvapptrmdaaqlteegyysvfgksgarieipgcslcmgnqarva
    dgatvvststrnfpnrlgtganvflasaelaavaaligklptpeeyqtyvaqvdktavdt
    yrylnfnqlsqytekadgvifqtav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l5jA (A:)
    mleeyrkhvaeraaegiapkpldanqmaalvellknppageeeflldlltnrvppgvdea
    ayvkagflaaiakgeaksplltpekaiellgtmqggynihplidalddaklapiaakals
    htllmfdnfydveekakagneyakqvmqswadaewflnrpalaekltvtvfkvtgetntd
    dlspapdawsrpdiplhalamlknaregiepdqpgvvgpikqiealqqkgfplayvgdvv
    gtgssrksatnsvlwfmgddiphvpnkrggglclggkiapiffntmedagalpievdvsn
    lnmgdvidvypykgevrnhetgellatfelktdvlidevraggripliigrglttkarea
    lglphsdvfrqakdvaesdrgfslaqkmvgracgvkgirpgaycepkmtsvgsqdttgpm
    trdelkdlaclgfsadlvmqsfchtaaypkpvdvnthhtlpdfimnrggvslrpgdgvih
    swlnrmllpdtvgtggdshtrfpigisfpagsglvafaaatgvmpldmpesvlvrfkgkm
    qpgitlrdlvhaiplyaikqglltvekkgkknifsgrileieglpdlkveqafeltdasa
    ersaagctiklnkepiieylnsnivllkwmiaegygdrrtlerriqgmekwlanpellea
    dadaeyaavididladikepilcapndpddarplsavqgekidevfigscmtnighfraa
    gklldahkgqlptrlwvapptrmdaaqlteegyysvfgksgarieipgcslcmgnqarva
    dgatvvststrnfpnrlgtganvflasaelaavaaligklptpeeyqtyvaqvdktavdt
    yrylnfnqlsqytekadgvifq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l5jB (B:)
    mleeyrkhvaeraaegiapkpldanqmaalvellknppageeeflldlltnrvppgvdea
    ayvkagflaaiakgeaksplltpekaiellgtmqggynihplidalddaklapiaakals
    htllmfdnfydveekakagneyakqvmqswadaewflnrpalaekltvtvfkvtgetntd
    dlspapdawsrpdiplhalamlknaregiepdqpgvvgpikqiealqqkgfplayvgdvv
    gtgssrksatnsvlwfmgddiphvpnkrggglclggkiapiffntmedagalpievdvsn
    lnmgdvidvypykgevrnhetgellatfelktdvlidevraggripliigrglttkarea
    lglphsdvfrqakdvaesdrgfslaqkmvgracgvkgirpgaycepkmtsvgsqdttgpm
    trdelkdlaclgfsadlvmqsfchtaaypkpvdvnthhtlpdfimnrggvslrpgdgvih
    swlnrmllpdtvgtggdshtrfpigisfpagsglvafaaatgvmpldmpesvlvrfkgkm
    qpgitlrdlvhaiplyaikqglltvekkgkknifsgrileieglpdlkveqafeltdasa
    ersaagctiklnkepiieylnsnivllkwmiaegygdrrtlerriqgmekwlanpellea
    dadaeyaavididladikepilcapndpddarplsavqgekidevfigscmtnighfraa
    gklldahkgqlptrlwvapptrmdaaqlteegyysvfgksgarieipgcslcmgnqarva
    dgatvvststrnfpnrlgtganvflasaelaavaaligklptpeeyqtyvaqvdktavdt
    yrylnfnqlsqytekadgvifqtav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l5jB (B:)
    mleeyrkhvaeraaegiapkpldanqmaalvellknppageeeflldlltnrvppgvdea
    ayvkagflaaiakgeaksplltpekaiellgtmqggynihplidalddaklapiaakals
    htllmfdnfydveekakagneyakqvmqswadaewflnrpalaekltvtvfkvtgetntd
    dlspapdawsrpdiplhalamlknaregiepdqpgvvgpikqiealqqkgfplayvgdvv
    gtgssrksatnsvlwfmgddiphvpnkrggglclggkiapiffntmedagalpievdvsn
    lnmgdvidvypykgevrnhetgellatfelktdvlidevraggripliigrglttkarea
    lglphsdvfrqakdvaesdrgfslaqkmvgracgvkgirpgaycepkmtsvgsqdttgpm
    trdelkdlaclgfsadlvmqsfchtaaypkpvdvnthhtlpdfimnrggvslrpgdgvih
    swlnrmllpdtvgtggdshtrfpigisfpagsglvafaaatgvmpldmpesvlvrfkgkm
    qpgitlrdlvhaiplyaikqglltvekkgkknifsgrileieglpdlkveqafeltdasa
    ersaagctiklnkepiieylnsnivllkwmiaegygdrrtlerriqgmekwlanpellea
    dadaeyaavididladikepilcapndpddarplsavqgekidevfigscmtnighfraa
    gklldahkgqlptrlwvapptrmdaaqlteegyysvfgksgarieipgcslcmgnqarva
    dgatvvststrnfpnrlgtganvflasaelaavaaligklptpeeyqtyvaqvdktavdt
    yrylnfnqlsqytekadgvifq