PDB entry 1l5h

View 1l5h on RCSB PDB site
Description: FeMo-cofactor Deficient Nitrogenase MoFe Protein
Deposited on 2002-03-06, released 2002-04-17
The last revision prior to the SCOP 1.63 freeze date was dated 2002-04-17, with a file datestamp of 2002-04-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.249
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1l5ha_
  • Chain 'B':
    Domains in SCOP 1.63: d1l5hb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l5hA (A:)
    nkksqpglmtirgcayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvna
    fvtmnftsdfqekdivfggdkklaklidevetlfplnkgisvqsecpigligddiesvsk
    vkgaelsktivpvrcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigd
    yniggdawssrilleemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmee
    kygipwmeynffgptktieslraiaakfdesiqkkceeviakykpeweavvakyrprleg
    krvmlyigglrprhvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgye
    feefvkrikpdligsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtln
    npcwkklqapwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l5hA (A:)
    nkksqpglmtirgcayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvna
    fvtmnftsdfqekdivfggdkklaklidevetlfplnkgisvqsecpigligddiesvsk
    vkgaelsktivpvrcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigd
    yniggdawssrilleemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmee
    kygipwmeynffgptktieslraiaakfdesiqkkceeviakykpeweavvakyrprleg
    krvmlyigglrprhvigayedlgmevvgtgyeefeefvkrikpdligsgikekfifqkmg
    ipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l5hB (B:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr