PDB entry 1l5c

View 1l5c on RCSB PDB site
Description: Solution Structure of the Monomeric Form of a Mutant Unliganded Bovine Neurophysin, 20 Structures
Class: hormone/growth factor
Keywords: nmr analysis neurophysin monomer, hormone/growth factor complex
Deposited on 2002-03-06, released 2002-03-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: neurophysin 1
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01175 (0-91)
    • engineered (79)
  Domains in SCOPe 2.08: d1l5ca_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1l5cA (A:)
  avldldvrtclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkp
  cgsggrcaaagiccspdgceedpacdpeaafs