PDB entry 1l5a

View 1l5a on RCSB PDB site
Description: Crystal Structure of VibH, an NRPS Condensation Enzyme
Class: biosynthetic protein
Keywords: nonribosomal peptide synthetase, NRPS condensation domain, amide synthase, vibriobactin, BIOSYNTHETIC PROTEIN
Deposited on 2002-03-06, released 2002-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.214
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amide synthase
    Species: Vibrio cholerae [TaxId:666]
    Gene: vibH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l5aa1, d1l5aa2
  • Chain 'B':
    Compound: amide synthase
    Species: Vibrio cholerae [TaxId:666]
    Gene: vibH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l5ab1, d1l5ab2
  • Chain 'C':
    Compound: amide synthase
    Species: Vibrio cholerae [TaxId:666]
    Gene: vibH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l5ac1, d1l5ac2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l5aA (A:)
    mllaqkpfwqrhlayphinldtvahslrltgpldttlllralhltvseidlfrarfsaqg
    elywhpfsppidyqdlsihleaeplawrqieqdlqrsstlidapitshqvyrlshsehli
    ytrahhivldgygmmlfeqrlsqhyqsllsgqtptaafkpyqsyleeeaayltshrywqd
    kqfwqgylreapdltltsatydpqlshavslsytlnsqlnhlllklananqigwpdalva
    lcalylesaepdapwlwlpfmnrwgsvaanvpglmvnslpllrlsaqqtslgnylkqsgq
    airslylhgryrieqieqdqglnaeqsyfmspfinilpfesphfadcqtelkvlasgsae
    ginftfrgspqhelclditadlasypqshwqshcerfprffeqllarfqqveqdvarlla
    epaalaattstraias
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l5aA (A:)
    mllaqkpfwqrhlayphinldtvahslrltgpldttlllralhltvseidlfrarfsaqg
    elywhpfsppidyqdlsihleaeplawrqieqdlqrsstlidapitshqvyrlshsehli
    ytrahhivldgygmmlfeqrlsqhyqsllsgqtptaafkpyqsyleeeaayltshrywqd
    kqfwqgylreapdltltsatydpqlshavslsytlnsqlnhlllklananqigwpdalva
    lcalylesaepdapwlwlpfmnrwgsvaanvpglmvnslpllrlsaqqtslgnylkqsgq
    airslylhgryrieqieqdqglnaeqsyfmspfinilpfesphfadcqtelkvlasgsae
    ginftfrgspqhelclditadlasypqshwqshcerfprffeqllarfqqveqdvarlla
    epaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l5aB (B:)
    mllaqkpfwqrhlayphinldtvahslrltgpldttlllralhltvseidlfrarfsaqg
    elywhpfsppidyqdlsihleaeplawrqieqdlqrsstlidapitshqvyrlshsehli
    ytrahhivldgygmmlfeqrlsqhyqsllsgqtptaafkpyqsyleeeaayltshrywqd
    kqfwqgylreapdltltsatydpqlshavslsytlnsqlnhlllklananqigwpdalva
    lcalylesaepdapwlwlpfmnrwgsvaanvpglmvnslpllrlsaqqtslgnylkqsgq
    airslylhgryrieqieqdqglnaeqsyfmspfinilpfesphfadcqtelkvlasgsae
    ginftfrgspqhelclditadlasypqshwqshcerfprffeqllarfqqveqdvarlla
    epaalaattstraias
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l5aB (B:)
    mllaqkpfwqrhlayphinldtvahslrltgpldttlllralhltvseidlfrarfsaqg
    elywhpfsppidyqdlsihleaeplawrqieqdlqrsstlidapitshqvyrlshsehli
    ytrahhivldgygmmlfeqrlsqhyqsllsgqtptaafkpyqsyleeeaayltshrywqd
    kqfwqgylreapdltltsatydpqlshavslsytlnsqlnhlllklananqigwpdalva
    lcalylesaepdapwlwlpfmnrwgsvaanvpglmvnslpllrlsaqqtslgnylkqsgq
    airslylhgryrieqieqdqglnaeqsyfmspfinilpfesphfadcqtelkvlasgsae
    ginftfrgspqhelclditadlasypqshwqshcerfprffeqllarfqqveqdvarlla
    epaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1l5aC (C:)
    mllaqkpfwqrhlayphinldtvahslrltgpldttlllralhltvseidlfrarfsaqg
    elywhpfsppidyqdlsihleaeplawrqieqdlqrsstlidapitshqvyrlshsehli
    ytrahhivldgygmmlfeqrlsqhyqsllsgqtptaafkpyqsyleeeaayltshrywqd
    kqfwqgylreapdltltsatydpqlshavslsytlnsqlnhlllklananqigwpdalva
    lcalylesaepdapwlwlpfmnrwgsvaanvpglmvnslpllrlsaqqtslgnylkqsgq
    airslylhgryrieqieqdqglnaeqsyfmspfinilpfesphfadcqtelkvlasgsae
    ginftfrgspqhelclditadlasypqshwqshcerfprffeqllarfqqveqdvarlla
    epaalaattstraias
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l5aC (C:)
    mllaqkpfwqrhlayphinldtvahslrltgpldttlllralhltvseidlfrarfsaqg
    elywhpfsppidyqdlsihleaeplawrqieqdlqrsstlidapitshqvyrlshsehli
    ytrahhivldgygmmlfeqrlsqhyqsllsgqtptaafkpyqsyleeeaayltshrywqd
    kqfwqgylreapdltltsatydpqlshavslsytlnsqlnhlllklananqigwpdalva
    lcalylesaepdapwlwlpfmnrwgsvaanvpglmvnslpllrlsaqqtslgnylkqsgq
    airslylhgryrieqieqdqglnaeqsyfmspfinilpfesphfadcqtelkvlasgsae
    ginftfrgspqhelclditadlasypqshwqshcerfprffeqllarfqqveqdvarlla
    epaa