PDB entry 1l58

View 1l58 on RCSB PDB site
Description: analysis of the interaction between charged side chains and the alpha-helix dipole using designed thermostable mutants of phage t4 lysozyme
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl)
Deposited on 1991-05-06, released 1991-10-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-03-02, with a file datestamp of 2010-02-26.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.167
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: t4 lysozyme
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-163)
      • conflict (142)
    Domains in SCOPe 2.03: d1l58a_
  • Heterogens: BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l58A (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtanrakrvittfrtgtwdayknl