PDB entry 1l57

View 1l57 on RCSB PDB site
Description: analysis of the interaction between charged side chains and the alpha- helix dipole using designed thermostable mutants of phage t4 lysozyme
Deposited on 1991-05-06, released 1991-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1991-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.163
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1l57__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1l57_ (-)
  mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
  deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftdslrm
  lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk