PDB entry 1l52

View 1l52 on RCSB PDB site
Description: structural and thermodynamic analysis of the packing of two alpha- helices in bacteriophage t4 lysozyme
Deposited on 1991-01-28, released 1991-10-15
The last revision prior to the SCOP 1.59 freeze date was dated 1991-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.159
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1l52__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1l52_ (-)
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvitsfrtgtwdayknl