PDB entry 1l50

View 1l50 on RCSB PDB site
Description: structural and thermodynamic analysis of the packing of two alpha- helices in bacteriophage t4 lysozyme
Deposited on 1991-01-28, released 1991-10-15
The last revision prior to the SCOP 1.59 freeze date was dated 1991-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.85 Å
R-factor: 0.165
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1l50__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1l50_ (-)
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcvlinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrcitsfrtgtwdayknl