PDB entry 1l4w

View 1l4w on RCSB PDB site
Description: NMR structure of an AChR-peptide (Torpedo Californica, alpha-subunit residues 182-202) in complex with alpha-Bungarotoxin
Class: Receptor, Toxin
Keywords: protein-protein complex,intermolecular beta sheet, bungarotoxin, acetylcholine receptor, Receptor, Toxin
Deposited on 2002-03-06, released 2002-07-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-bungarotoxin
    Species: Bungarus multicinctus [TaxId:8616]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1l4wa_
  • Chain 'B':
    Compound: acetylcholine receptor protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02711 (2-22)
      • insertion (0-1)
      • insertion (23-24)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l4wA (A:)
    ivchttatspisavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
    stdkcnphpkqrpg
    

  • Chain 'B':
    No sequence available.