PDB entry 1l4u

View 1l4u on RCSB PDB site
Description: crystal structure of shikimate kinase from mycobacterium tuberculosis in complex with mgadp and pt(II) at 1.8 angstrom resolution
Class: transferase
Keywords: shikimate pathway, shikimate kinase, phorsphoryl transfer, drug design, transferase
Deposited on 2002-03-05, released 2002-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shikimate kinase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: AroK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l4ua_
  • Heterogens: PT, MG, CL, ADP, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l4uA (A:)
    mapkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrri
    eedvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrpll
    agpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrlqvpspseaat
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l4uA (A:)
    apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie
    edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrplla
    gpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrl