PDB entry 1l4i

View 1l4i on RCSB PDB site
Description: Crystal Structure of the Periplasmic Chaperone SfaE
Class: chaperone
Keywords: periplasmic chaperone, immunoglobulin fold
Deposited on 2002-03-05, released 2002-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SfaE PROTEIN
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l4ia1, d1l4ia2
  • Chain 'B':
    Compound: SfaE PROTEIN
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l4ib1, d1l4ib2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l4iA (A:)
    gvalgatrviypegqkqvqlavtnnddkssyliqswienaegkkdarfvitpplfsmqgk
    kentlriidatngqmpedreslfwvnvkaipamdkaktgenylqfaivsrikllyrpqgl
    vippeqapgkleftrenggltlfnptpyyltvtdlkagnkslentmvppqgkvtvnipgg
    ytggdityktindygalteqvrgvvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l4iA (A:)
    gvalgatrviypegqkqvqlavtnnddkssyliqswienaegkkdarfvitpplfsmqgk
    kentlriidatngqmpedreslfwvnvkaipamdlqfaivsrikllyrpqglvippeqap
    gkleftreltlfnptpyyltvtdlkagnkslentmvppqgkvtvniggdityktindyga
    lteqvrgvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l4iB (B:)
    gvalgatrviypegqkqvqlavtnnddkssyliqswienaegkkdarfvitpplfsmqgk
    kentlriidatngqmpedreslfwvnvkaipamdkaktgenylqfaivsrikllyrpqgl
    vippeqapgkleftrenggltlfnptpyyltvtdlkagnkslentmvppqgkvtvnipgg
    ytggdityktindygalteqvrgvvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l4iB (B:)
    gvalgatrviypegqkqvqlavtnnddkssyliqswienaegkkdarfvitpplfsmqgk
    kentlriidatngqmpedreslfwvnvkaipamqfaivsrikllyrpqglvippeqapgk
    leftreltlfnptpyyltvtdlkagnkslentmvppqgkvtvnipggdityktindygal
    teqvrgvvk