PDB entry 1l49

View 1l49 on RCSB PDB site
Description: structural and thermodynamic analysis of the packing of two alpha- helices in bacteriophage t4 lysozyme
Deposited on 1991-01-28, released 1991-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1991-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.166
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1l49__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l49_ (-)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrrcvlinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvitsfrtgtwdayknl