PDB entry 1l48

View 1l48 on RCSB PDB site
Description: structural and thermodynamic analysis of the packing of two alpha-helices in bacteriophage t4 lysozyme
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl)
Deposited on 1991-01-28, released 1991-10-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.166
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: t4 lysozyme
  Species: Enterobacteria phage T4 [TaxId:10665]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00720 (0-163)
    • conflict (97)
  Domains in SCOPe 2.06: d1l48a_
• Heterogens: BME, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1l48A (A:)
  mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
  deaeklfnqdvdaavrgilrnaklkpvydsldavrrcvlinmvfqmgetgvagftnslrm
  lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl