PDB entry 1l44

View 1l44 on RCSB PDB site
Description: cumulative site-directed charge-change replacements in bacteriophage t4 lysozyme suggest that long-range electrostatic interactions contribute little to protein stability
Deposited on 1991-01-28, released 1991-10-15
The last revision prior to the SCOP 1.57 freeze date was dated 1991-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.165
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1l44__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1l44_ (-)
  mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
  deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslem
  lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl