PDB entry 1l3x

View 1l3x on RCSB PDB site
Description: Solution Structure of Novel Disintegrin Salmosin
Class: protein binding
Keywords: Disintegrin, Snake Venome, RGD, PROTEIN BINDING
Deposited on 2002-03-01, released 2003-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-21, with a file datestamp of 2012-11-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: platelet aggregation inhibitor disintegrin
    Species: Gloydius blomhoffi brevicaudus [TaxId:259325]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l3xa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l3xA (A:)
    eageecdcgspgnpccdaatcklrqgaqcaeglccdqcrfmkegticrrargddlddycn
    gisagcprnpfha