PDB entry 1l3o

View 1l3o on RCSB PDB site
Description: solution structure determination of the fully oxidized double mutant k9-10a cytochrome c7 from desulfuromonas acetoxidans, ensemble of 35 structures
Class: oxygen storage/transport
Keywords: automatic assignment, cytochrome c7, electron transfer, multiheme cytochromes, NMR solution structures, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2002-02-28, released 2002-03-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c7
  Species: Desulfuromonas acetoxidans [TaxId:891]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00137 (0-67)
    • engineered (8-9)
  Domains in SCOPe 2.08: d1l3oa_
• Heterogens: HEC

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1l3oA (A:)
  advvtyenaagnvtfdhkahaeklgcdachegtpakiaidkksahkdacktchksnngpt
  kcggchik