PDB entry 1l3k

View 1l3k on RCSB PDB site
Description: up1, the two RNA-recognition motif domain of hnrnp a1
Class: RNA binding protein
Keywords: nuclear protein hnrnp a1, RNA-recognition motif, RNA-binding, up1, RNA binding protein
Deposited on 2002-02-27, released 2002-04-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.156
AEROSPACI score: 0.9 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heterogeneous nuclear ribonucleoprotein a1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1l3ka1, d1l3ka2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l3kA (A:)
    msksespkepeqlrklfigglsfettdeslrshfeqwgtltdcvvmrdpntkrsrgfgfv
    tyatveevdaamnarphkvdgrvvepkravsredsqrpgahltvkkifvggikedteehh
    lrdyfeqygkievieimtdrgsgkkrgfafvtfddhdsvdkiviqkyhtvnghncevrka
    lskqemasasssqrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l3kA (A:)
    kepeqlrklfigglsfettdeslrshfeqwgtltdcvvmrdpntkrsrgfgfvtyatvee
    vdaamnarphkvdgrvvepkravstvkkifvggikedteehhlrdyfeqygkievieimt
    drgsgkkrgfafvtfddhdsvdkiviqkyhtvnghncevrkal