PDB entry 1l3h

View 1l3h on RCSB PDB site
Description: NMR structure of P41icf, a potent inhibitor of human cathepsin L
Class: immune system
Keywords: alpha helix, beta sheet, disulfide bonds, immune system
Deposited on 2002-02-27, released 2003-03-04
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC CLASS II-ASSOCIATED P41 INVARIANT CHAIN FRAGMENT (P41icf)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1l3ha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l3hA (A:)
    ltkcqeevshipavhpgsfrpkcdengnylplqcygsigycwcvfpngtevpntrsrghh
    ncses