PDB entry 1l3h

View 1l3h on RCSB PDB site
Description: NMR structure of P41icf, a potent inhibitor of human cathepsin L
Class: immune system
Keywords: alpha helix, beta sheet, disulfide bonds
Deposited on 2002-02-27, released 2003-03-04
The last revision prior to the SCOP 1.73 freeze date was dated 2003-03-04, with a file datestamp of 2007-06-04.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC CLASS II-ASSOCIATED P41 INVARIANT CHAIN FRAGMENT (P41icf)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1l3ha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l3hA (A:)
    ltkcqeevshipavhpgsfrpkcdengnylplqcygsigycwcvfpngtevpntrsrghh
    ncses