PDB entry 1l3g

View 1l3g on RCSB PDB site
Description: NMR Structure of the DNA-binding Domain of Cell Cycle Protein, Mbp1(2-124) from Saccharomyces cerevisiae
Class: cell cycle
Keywords: cell cycle, Mlu 1 cell cycle box Binding Protein, winged helix-turn-helix proteins
Deposited on 2002-02-27, released 2003-02-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription factor mbp1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1l3ga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l3gA (A:)
    snqiysarysgvdvyefihstgsimkrkkddwvnathilkaanfakakrtrilekevlke
    thekvqggfgkyqgtwvplniakqlaekfsvydqlkplfdftqtdgsaspppapkhhhas
    kvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l3gA (A:)
    snqiysarysgvdvyefihstgsimkrkkddwvnathilkaanfakakrtrilekevlke
    thekvqggfgkyqgtwvplniakqlaekfsvydqlkplfdftqtdgsaspppapkhhhas
    kvd