PDB entry 1l3e

View 1l3e on RCSB PDB site
Description: NMR Structures of the HIF-1alpha CTAD/p300 CH1 Complex
Class: transcription
Keywords: protein-protein complex, transcription
Deposited on 2002-02-26, released 2002-04-24
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypoxia inducible factor-1 alpha subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: hypoxia inducible factor-1 alpha
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16665 (0-41)
      • cloning artifact (0)
    Domains in SCOPe 2.01: d1l3ea_
  • Chain 'B':
    Compound: p300 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: p300
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1l3eb_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l3eA (A:)
    gsmdesglpqltsydcevnapiqgsrnllqgeellraldqvn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l3eB (B:)
    mgsgahtadpekrkliqqqlvlllhahkcqrreqangevrqcnlphcrtmknvlnhmthc
    qsgkscqvahcassrqiishwknctrhdcpvclplknagdk