PDB entry 1l3e

View 1l3e on RCSB PDB site
Description: nmr structures of the hif-1alpha ctad/p300 ch1 complex
Deposited on 2002-02-26, released 2002-04-24
The last revision prior to the SCOP 1.65 freeze date was dated 2002-04-24, with a file datestamp of 2002-04-24.
Experiment type: NMR17
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1l3ea_
  • Chain 'B':
    Domains in SCOP 1.65: d1l3eb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l3eA (A:)
    gsmdesglpqltsydcevnapiqgsrnllqgeellraldqvn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l3eB (B:)
    mgsgahtadpekrkliqqqlvlllhahkcqrreqangevrqcnlphcrtmknvlnhmthc
    qsgkscqvahcassrqiishwknctrhdcpvclplknagdk