PDB entry 1l35

View 1l35 on RCSB PDB site
Description: structure of a thermostable disulfide-bridge mutant of phage t4 lysozyme shows that an engineered crosslink in a flexible region does not increase the rigidity of the folded protein
Deposited on 1989-10-26, released 1990-01-15
The last revision prior to the SCOP 1.71 freeze date was dated 1991-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.157
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.71: d1l35__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1l35_ (-)
  mnifemlrcdeglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
  deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
  lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknc