PDB entry 1l34

View 1l34 on RCSB PDB site
Description: high-resolution structure of the temperature-sensitive mutant of phage lysozyme, arg 96 (right arrow) his
Deposited on 1989-05-01, released 1990-01-15
The last revision prior to the SCOP 1.71 freeze date was dated 1990-01-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.176
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1l34__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1l34_ (-)
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrhcalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl